PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016453357.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 782aa    MW: 88099.2 Da    PI: 9.9328
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016453357.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.91.2e-15229321498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      + ps+v++   l++  kfa+++ +++ ++  l++  +   sW+vk+  + ++   +  +GWk Fv +n+Lk gD +vF++++ ++    v++fr
  XP_016453357.1 229 FMQPSYVFSPFSLSVALKFARKYFLENYGNLVLRVPGKGRGSWSVKC--TTRGTNATVYSGWKAFVLDNKLKCGDACVFEVIKGTRLFIDVTIFR 321
                     6889*******************88888887788888888*******..66666777889********************987655556677766 PP

2B341.91.8e-13484574598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfr 98 
                     + ps+v+k   l ++  fa ++  +k ++  l+l+ +   sW vk+   k+++++ ++  Wk Fv +n+L+ gD++vF+l++  ++  l v++fr
  XP_016453357.1 484 MQPSYVSKPYSLQISLLFAVKYFREK-CG-NLVLRVPGRGSWPVKYALGKSKSKICFS--WKAFVLDNKLNFGDVCVFELIKGgTKPILDVTIFR 574
                     67999999999***********7554.43.8***************999999999999..********************976566667777776 PP

3B346.28.1e-15686770793
                     .-HHHHT...T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-.SSSEE..E CS
              B3   7 psdvlks...grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld.grsefelv 93 
                     ps+v++     +l++  + a+++ +   ++ +++l+ +s +sW vk+i   +     l++GWkeFv +n+Lk+gD++vF+++ +r +  l+
  XP_016453357.1 686 PSYVSSAsgpVQLSITLERARKFFST--RHSDVVLRVSSKKSWAVKCIL--GTVNAKLSSGWKEFVLDNNLKVGDVCVFERViSRPK--LL 770
                     44444445556799999999999755..4558***************65..333346***********************5523333..34 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.743165IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-10576IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-10565IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.2E-20218322IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-18219321IPR015300DNA-binding pseudobarrel domain
CDDcd100172.32E-16224321No hitNo description
PROSITE profilePS5086311.335226323IPR003340B3 DNA binding domain
SMARTSM010194.7E-11226323IPR003340B3 DNA binding domain
PfamPF023621.2E-12228321IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.8E-18472575IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-18473574IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.3E-13479576IPR003340B3 DNA binding domain
PROSITE profilePS5086310.785480576IPR003340B3 DNA binding domain
CDDcd100174.21E-16484574No hitNo description
PfamPF023627.9E-11484574IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-21672777IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.88E-18673777IPR015300DNA-binding pseudobarrel domain
CDDcd100175.26E-15678776No hitNo description
SMARTSM010199.3E-6680774IPR003340B3 DNA binding domain
PROSITE profilePS5086311.998683779IPR003340B3 DNA binding domain
PfamPF023621.7E-12696771IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MLNPVYLEVP TGEVWEVEVV LSQGQICLGI GWQDFSDFYS ISCGHFLMFG YNARSHFNVT  60
IFDLSASEIE YPYSSAHGIH TPISYSHETH HAPERDQSES DDSVEILEGI PRSQKPNAII  120
PDMVENSVEN LDHCPLVQSS KRQRQEGDAE DDVSVDMHIK KMKVEKLRED VASPSFIRKG  180
QKRNKGCRTH KQQSESVYGQ HKSVMDKERA VAYQRAKAFK SKNPFIISFM QPSYVFSPFS  240
LSVALKFARK YFLENYGNLV LRVPGKGRGS WSVKCTTRGT NATVYSGWKA FVLDNKLKCG  300
DACVFEVIKG TRLFIDVTIF RAAWSTLMHK IVGEVPGGSD SKSNVIKTDN CVPCSQLKVV  360
HTKKLKQRTE EHGEGTEIEH SVEILGNYPL VHGSKRNRPE GEAEGDVSID LHTKSINVEN  420
TQKHVTSPSI TRKTKRSGES CRMHKQQSKL VYAMNKTVLD KEMSIAYQRA KAFKSENPFV  480
IYFMQPSYVS KPYSLQISLL FAVKYFREKC GNLVLRVPGR GSWPVKYALG KSKSKICFSW  540
KAFVLDNKLN FGDVCVFELI KGGTKPILDV TIFRAAKSKP MHKIDAKLAR VSDHKNKTIK  600
TEKSVPCSQH KIFHSKKLNL EKKQKGDSDG FTSKIKEEFS EDTGKHVQQS KSSCKGSAVA  660
KEMVLAYQRA KAFTSENPFF ICLMQPSYVS SASGPVQLSI TLERARKFFS TRHSDVVLRV  720
SSKKSWAVKC ILGTVNAKLS SGWKEFVLDN NLKVGDVCVF ERVISRPKLL FNVIIFTSAE  780
GR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A7e-1519577018141B3 domain-containing transcription factor VRN
4i1k_B7e-1519577018141B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-50HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-50HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016453357.10.0PREDICTED: B3 domain-containing protein Os03g0619600-like
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-31B3 family protein